View larger

PPFIA3 polyclonal antibody (A01)

Reference:

Condition: New product

Data sheet of PPFIA3 polyclonal antibody (A01)

Brand:	Abnova
Reference:	H00008541-A01
Product name:	PPFIA3 polyclonal antibody (A01)
Product description:	Mouse polyclonal antibody raised against a partial recombinant PPFIA3.
Gene id:	8541
Gene name:	PPFIA3
Gene alias:	KIAA0654\|LPNA3\|MGC126567\|MGC126569
Gene description:	protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein (liprin), alpha 3
Genbank accession:	NM_003660
Immunogen:	PPFIA3 (NP_003651, 1043 a.a. ~ 1139 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence:	NERVMGWVSGLGLKEFATNLTESGVHGALLALDETFDYSDLALLLQIPTQNAQARQLLEKEFSNLISLGTDRRLDEDSAKSFSRSPSWRKMFREKDL
Protein accession:	NP_003651
Storage buffer:	50 % glycerol
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody Reactive Against Recombinant Protein.
Quality control testing picture:
Quality control testing picture note:	Western Blot detection against Immunogen (36.78 KDa) .
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Application image:
Application image note:	PPFIA3 polyclonal antibody (A01), Lot # 060519JCS1 Western Blot analysis of PPFIA3 expression in 293 ( Cat # L026V1 ).
Applications:	WB-Ce,ELISA,WB-Re
Shipping condition:	Dry Ice