Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of API5 monoclonal antibody (M01), clone 1C2
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re |
More info about API5 monoclonal antibody (M01), clone 1C2
| Brand: | Abnova |
| Reference: | H00008539-M01 |
| Product name: | API5 monoclonal antibody (M01), clone 1C2 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant API5. |
| Clone: | 1C2 |
| Isotype: | IgG2b Kappa |
| Gene id: | 8539 |
| Gene name: | API5 |
| Gene alias: | AAC-11|AAC11 |
| Gene description: | apoptosis inhibitor 5 |
| Genbank accession: | BC017709 |
| Immunogen: | API5 (AAH17709, 400 a.a. ~ 504 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | GEALKTEENKIKVVALKITNNINVLIKDLFHIPPSYKSTVTLSWKPVQKVEIGQKRASEDTTSGSPPKKSSAGPKRDARQIYNPPSGKYSSNLGNFNYERSLQGK |
| Protein accession: | AAH17709 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.18 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to API5 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml] |
| Applications: | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Api5 Contributes to E2F1 Control of the G1/S Cell Cycle Phase Transition.Garcia-Jove Navarro M, Basset C, Arcondeguy T, Touriol C, Perez G, Prats H, Lacazette E PLoS One. 2013 Aug 7;8(8):e71443. doi: 10.1371/journal.pone.0071443. Print 2013. |