Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of DDO polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ti,ELISA,WB-Re |
More info about DDO polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00008528-A01 |
| Product name: | DDO polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant DDO. |
| Gene id: | 8528 |
| Gene name: | DDO |
| Gene alias: | DASOX|DDO-1|DDO-2|FLJ45203 |
| Gene description: | D-aspartate oxidase |
| Genbank accession: | NM_003649 |
| Immunogen: | DDO (NP_003640, 270 a.a. ~ 369 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | WNLSPDAENSREILSRCCALEPSLHGACNIREKVGLRPYRPGVRLQTELLARDGQRLPVVHHYGHGSGGISVHWGTALEAARLVSECVHALRTPIPKSNL |
| Protein accession: | NP_003640 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | DDO polyclonal antibody (A01). Western Blot analysis of DDO expression in human ovarian cancer. |
| Applications: | WB-Ti,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | D-Aspartate and D-Aspartate Oxidase Show Selective and Developmentally Dynamic Localization in Mouse Retina.Huang AS, Lee DA, Blackshaw S. Exp Eye Res. 2008 Apr;86(4):704-9. Epub 2008 Jan 25. |