No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA |
Brand: | Abnova |
Reference: | H00008522-M05 |
Product name: | GAS7 monoclonal antibody (M05), clone 1H3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant GAS7. |
Clone: | 1H3 |
Isotype: | IgG1 Kappa |
Gene id: | 8522 |
Gene name: | GAS7 |
Gene alias: | KIAA0394|MGC1348|MLL/GAS7 |
Gene description: | growth arrest-specific 7 |
Genbank accession: | BC001152 |
Immunogen: | GAS7 (AAH01152.1, 236 a.a. ~ 336 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | VEKPLMNFRENFKKDMKKCDHHIADLRKQLASRYASVEKARKALTERQRDLEMKTQQLEIKLSNKTEEDIKKARRKSTQAGDDLMRCVDLYNQAQSKWFEE |
Protein accession: | AAH01152.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Detection limit for recombinant GST tagged GAS7 is 0.03 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |