| Brand: | Abnova |
| Reference: | H00008516-M02 |
| Product name: | ITGA8 monoclonal antibody (M02), clone 2G7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ITGA8. |
| Clone: | 2G7 |
| Isotype: | IgG2b Kappa |
| Gene id: | 8516 |
| Gene name: | ITGA8 |
| Gene alias: | - |
| Gene description: | integrin, alpha 8 |
| Genbank accession: | NM_003638 |
| Immunogen: | ITGA8 (NP_003629, 836 a.a. ~ 935 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SDTILEVGWPFSARDEFLLYIFHIQTLGPLQCQPNPNINPQDIKPAASPEDTPELSAFLRNSTIPHLVRKRDVHVVEFHRQSPAKILNCTNIECLQISCA |
| Protein accession: | NP_003629 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged ITGA8 is 1 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Osteopontin Is an Activator of Human Adipose Tissue Macrophages and Directly Affects Adipocyte Function.Zeyda M, Gollinger K, Todoric J, Kiefer FW, Keck M, Aszmann O, Prager G, Zlabinger GJ, Petzelbauer P, Stulnig TM. Endocrinology. 2011 Apr 5. [Epub ahead of print] |