| Brand: | Abnova |
| Reference: | H00008513-M02 |
| Product name: | LIPF monoclonal antibody (M02), clone 3B3 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant LIPF. |
| Clone: | 3B3 |
| Isotype: | IgG1 Kappa |
| Gene id: | 8513 |
| Gene name: | LIPF |
| Gene alias: | GL|HGL|HLAL|MGC138477|MGC142271 |
| Gene description: | lipase, gastric |
| Genbank accession: | NM_004190 |
| Immunogen: | LIPF (NP_004181, 299 a.a. ~ 398 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | KSGKFQAYDWGSPVQNRMHYDQSQPPYYNVTAMNVPIAVWNGGKDLLADPQDVGLLLPKLPNLIYHKEIPFYNHLDFIWAMDAPQEVYNDIVSMISEDKK |
| Protein accession: | NP_004181 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged LIPF is approximately 0.1ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |