Brand: | Abnova |
Reference: | H00008507-M03 |
Product name: | ENC1 monoclonal antibody (M03), clone 3C10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ENC1. |
Clone: | 3C10 |
Isotype: | IgG1 Kappa |
Gene id: | 8507 |
Gene name: | ENC1 |
Gene alias: | CCL28|ENC-1|FLJ39259|KLHL35|KLHL37|NRPB|PIG10|TP53I10 |
Gene description: | ectodermal-neural cortex (with BTB-like domain) |
Genbank accession: | NM_003633 |
Immunogen: | ENC1 (NP_003624, 17 a.a. ~ 98 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | SINIYLFHKSSYADSVLTHLNLLRQQRLFTDVLLHAGNRTFPCHRAVLAACSRYFEAMFSGGLKESQDSEVNFDNSIHPEVL |
Protein accession: | NP_003624 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | ENC1 monoclonal antibody (M03), clone 3C10. Western Blot analysis of ENC1 expression in IMR-32 ( Cat # L008V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA |
Shipping condition: | Dry Ice |