| Brand: | Abnova |
| Reference: | H00008490-D01P |
| Product name: | RGS5 purified MaxPab rabbit polyclonal antibody (D01P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human RGS5 protein. |
| Gene id: | 8490 |
| Gene name: | RGS5 |
| Gene alias: | MST092|MST106|MST129|MSTP032|MSTP092|MSTP106|MSTP129 |
| Gene description: | regulator of G-protein signaling 5 |
| Genbank accession: | NM_003617 |
| Immunogen: | RGS5 (NP_003608.1, 1 a.a. ~ 181 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MCKGLAALPHSCLERAKEIKIKLGILLQKPDSVGDLVIPYNEKPEKPAKTQKTSLDEALQWRDSLDKLLQNNYGLASFKSFLKSEFSEENLEFWIACEDYKKIKSPAKMAEKAKQIYEEFIQTEAPKEVNIDHFTKDITMKNLVEPSLSSFDMAQKRIHALMEKDSLPRFVRSEFYQELIK |
| Protein accession: | NP_003608.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse,Rat |
| Application image: |  |
| Application image note: | RGS5 MaxPab rabbit polyclonal antibody. Western Blot analysis of RGS5 expression in human liver. |
| Applications: | WB-Ti,WB-Tr |
| Shipping condition: | Dry Ice |