Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of SEMA7A monoclonal antibody (M01), clone 3D3
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re |
More info about SEMA7A monoclonal antibody (M01), clone 3D3
| Brand: | Abnova |
| Reference: | H00008482-M01 |
| Product name: | SEMA7A monoclonal antibody (M01), clone 3D3 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SEMA7A. |
| Clone: | 3D3 |
| Isotype: | IgG2a Kappa |
| Gene id: | 8482 |
| Gene name: | SEMA7A |
| Gene alias: | CD108|CDw108|H-SEMA-K1|H-Sema-L|JMH|MGC126692|MGC126696|SEMAK1|SEMAL |
| Gene description: | semaphorin 7A, GPI membrane anchor (John Milton Hagen blood group) |
| Genbank accession: | NM_003612 |
| Immunogen: | SEMA7A (NP_003603, 536 a.a. ~ 633 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | EPHKECPNPKPDKAPLQKVSLAPNSRYYLSCPMESRHATYSWRHKENVEQSCEPGHQSPNCILFIENLTAQQYGHYFCEAQEGSYFREAQHWQLLPED |
| Protein accession: | NP_003603 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.52 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged SEMA7A is approximately 0.03ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Plexin C1 deficiency permits synaptotagmin 7–mediated macrophage migration and enhances mammalian lung fibrosis.Peng X, Moore M, Mathur A1, Zhou Y, Sun H, Gan Y, Herazo-Maya JD, Kaminski N, Hu X, Pan H, Ryu C, Osafo-Addo A, Homer RJ, Feghali-Bostwick C, Fares W, Gulati M, Hu B, Lee CG, Elias JA, Herzog EL. FASEB J. 2016 Sep 8. [Epub ahead of print] |