Brand: | Abnova |
Reference: | H00008462-M03 |
Product name: | KLF11 monoclonal antibody (M03), clone 10D8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant KLF11. |
Clone: | 10D8 |
Isotype: | IgG2a Kappa |
Gene id: | 8462 |
Gene name: | KLF11 |
Gene alias: | FKLF|FKLF1|MODY7|TIEG2|Tieg3 |
Gene description: | Kruppel-like factor 11 |
Genbank accession: | NM_003597 |
Immunogen: | KLF11 (NP_003588, 404 a.a. ~ 512 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | TYFKSSHLKAHLRTHTGEKPFNCSWDGCDKKFARSDELSRHRRTHTGEKKFVCPVCDRRFMRSDHLTKHARRHMTTKKIPGWQAEVGKLNRIASAESPGSPLVSMPASA |
Protein accession: | NP_003588 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse,Rat |
Application image: |  |
Application image note: | Immunofluorescence of monoclonal antibody to KLF11 on NIH/3T3 cell. [antibody concentration 10 ug/ml] |
Applications: | WB-Ce,IHC-P,IF,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |