Product successfully added to your shopping cart
Quantity
Total
There are 2 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 943,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 943,00 €
Data sheet of KLF11 monoclonal antibody (M01), clone 8F4
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re |
More info about KLF11 monoclonal antibody (M01), clone 8F4
| Brand: | Abnova |
| Reference: | H00008462-M01 |
| Product name: | KLF11 monoclonal antibody (M01), clone 8F4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant KLF11. |
| Clone: | 8F4 |
| Isotype: | IgG2a Kappa |
| Gene id: | 8462 |
| Gene name: | KLF11 |
| Gene alias: | FKLF|FKLF1|MODY7|TIEG2|Tieg3 |
| Gene description: | Kruppel-like factor 11 |
| Genbank accession: | NM_003597 |
| Immunogen: | KLF11 (NP_003588, 404 a.a. ~ 512 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | TYFKSSHLKAHLRTHTGEKPFNCSWDGCDKKFARSDELSRHRRTHTGEKKFVCPVCDRRFMRSDHLTKHARRHMTTKKIPGWQAEVGKLNRIASAESPGSPLVSMPASA |
| Protein accession: | NP_003588 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to KLF11 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml] |
| Applications: | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | A Novel Role of the Sp/KLF Transcription Factor KLF11 in Arresting Progression of Endometriosis.Daftary GS, Zheng Y, Tabbaa ZM, Schoolmeester JK, Gada RP, Grzenda AL, Mathison AJ, Keeney GL, Lomberk GA, Urrutia R PLoS One. 2013;8(3):e60165. doi: 10.1371/journal.pone.0060165. Epub 2013 Mar 28. |