Product successfully added to your shopping cart
Quantity
Total
There are 4 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 1 840,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 1 840,00 €
Data sheet of DYRK2 monoclonal antibody (M01), clone 3G5
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
More info about DYRK2 monoclonal antibody (M01), clone 3G5
| Brand: | Abnova |
| Reference: | H00008445-M01 |
| Product name: | DYRK2 monoclonal antibody (M01), clone 3G5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant DYRK2. |
| Clone: | 3G5 |
| Isotype: | IgG2a Kappa |
| Gene id: | 8445 |
| Gene name: | DYRK2 |
| Gene alias: | FLJ21217|FLJ21365 |
| Gene description: | dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 2 |
| Genbank accession: | BC005809 |
| Immunogen: | DYRK2 (AAH05809, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MNDHLHVGSHAHGQIQVQQLFEDNSNKRTVLTTQPNGLTTVGKTGLPVVPERQLDSIHRRQGSSTSLKSMEGMGKVKATPMTPEQAMKQYMQKLTAFEHH |
| Protein accession: | AAH05809 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged DYRK2 is approximately 0.03ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |