Cart 61 Product Products 21 644,49 € (empty)
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x HUNK...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
No products
To be determined Shipping
21 644,49 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 61 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 21 644,49 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 21 644,49 €
Data sheet of BCAR3 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re,WB-Tr |
More info about BCAR3 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00008412-A01 |
| Product name: | BCAR3 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant BCAR3. |
| Gene id: | 8412 |
| Gene name: | BCAR3 |
| Gene alias: | KIAA0554|NSP2|SH2D3B |
| Gene description: | breast cancer anti-estrogen resistance 3 |
| Genbank accession: | BC039895 |
| Immunogen: | BCAR3 (AAH39895, 266 a.a. ~ 373 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | YGTSPGQAREGSLTKGRPDVAKRLSLTMGGVQAREQNLPRGNLLRNKEKSGSQPACLDHMQDRRALSLKAHQSESYLPIGCKLPPQSSGVDTSPCPNSPVFRTGSEPA |
| Protein accession: | AAH39895 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.88 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of BCAR3 expression in transfected 293T cell line by BCAR3 polyclonal antibody (A01). Lane1:BCAR3 transfected lysate(93 KDa). Lane2:Non-transfected lysate. |
| Applications: | ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |