Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | WB-Tr |
Brand: | Abnova |
Reference: | H00008399-D01P |
Product name: | PLA2G10 purified MaxPab rabbit polyclonal antibody (D01P) |
Product description: | Rabbit polyclonal antibody raised against a full-length human PLA2G10 protein. |
Gene id: | 8399 |
Gene name: | PLA2G10 |
Gene alias: | GXPLA2|GXSPLA2|MGC119918|MGC119919|MGC133367|SPLA2 |
Gene description: | phospholipase A2, group X |
Genbank accession: | NM_003561.1 |
Immunogen: | PLA2G10 (NP_003552.1, 1 a.a. ~ 165 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MGPLPVCLPIMLLLLLPSLLLLLLLPGPGSGEASRILRVHRRGILELAGTVGCVGPRTPIAYMKYGCFCGLGGHGQPRDAIDWCCHGHDCCYTRAEEAGCSPKTERYSWQCVNQSVLCGPAENKCQELLCKCDQEIANCLAQTEYNLKYLFYPQFLCEPDSPKCD |
Protein accession: | NP_003552.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of PLA2G10 expression in transfected 293T cell line (H00008399-T02) by PLA2G10 MaxPab polyclonal antibody. Lane 1: PLA2G10 transfected lysate(18.20 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Tr |
Shipping condition: | Dry Ice |
Publications: | HDAC Inhibition Induces Increased Choline Uptake and Elevated Phosphocholine Levels in MCF7 Breast Cancer Cells.Ward CS, Eriksson P, Izquierdo-Garcia JL, Brandes AH, Ronen SM PLoS One. 2013 Apr 23;8(4):e62610. doi: 10.1371/journal.pone.0062610. Print 2013. |