| Brand: | Abnova |
| Reference: | H00008372-M01 |
| Product name: | HYAL3 monoclonal antibody (M01), clone 3A3 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant HYAL3. |
| Clone: | 3A3 |
| Isotype: | IgG2a Kappa |
| Gene id: | 8372 |
| Gene name: | HYAL3 |
| Gene alias: | LUCA-3|LUCA14|LUCA3|Minna14 |
| Gene description: | hyaluronoglucosaminidase 3 |
| Genbank accession: | BC005896 |
| Immunogen: | HYAL3 (AAH05896, 1 a.a. ~ 417 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MTTQLGPALVLGVALCLGCGQPLPQVPERPFSVLWNVPSAHCEARFGVHLPLNSLGIIANRGQHFHGQNMTIFYKNQLGLYPYFGPRGTAHNGGIPQALPLDRHLALAAYQIHHSLRPGFAGPAVLDWEEWCPLWAGNWGRRRAYQAASWAWAQQVFPDLDPQEQLYKAYTGFEQAARALMEDTLRVAQALRPHGLWGFYHYPACGNGWHSMASNYTGRCHAATLARNTQLHWLWAASSALFPSIYLPPRLPPAHHQAFVRHRLEEAFRVALVGHRHPLPVLAYVRLTHRRSGRFLSQDDLVQSIGVSAALGAAGVVLWGDLSLSSSEEECWHLHDYLVDTLGPYVINVTRAAMACSHQRCHGHGRCARRDPGQMEAFLHLWPDGSLGDWKSFSCHCYWGWAGPTCQEPRPGPKEAV |
| Protein accession: | AAH05896 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |
| Publications: | Hyaluronidase Expression and Activity Is Regulated by Pro-Inflammatory Cytokines in Human Airway Epithelial Cells.Monzon ME, Manzanares D, Schmid N, Casalino-Matsuda SM, Forteza RM. Am J Respir Cell Mol Biol. 2008 Sep;39(3):289-95. Epub 2008 Apr 3. |