No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA |
Brand: | Abnova |
Reference: | H00008372-M01 |
Product name: | HYAL3 monoclonal antibody (M01), clone 3A3 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant HYAL3. |
Clone: | 3A3 |
Isotype: | IgG2a Kappa |
Gene id: | 8372 |
Gene name: | HYAL3 |
Gene alias: | LUCA-3|LUCA14|LUCA3|Minna14 |
Gene description: | hyaluronoglucosaminidase 3 |
Genbank accession: | BC005896 |
Immunogen: | HYAL3 (AAH05896, 1 a.a. ~ 417 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MTTQLGPALVLGVALCLGCGQPLPQVPERPFSVLWNVPSAHCEARFGVHLPLNSLGIIANRGQHFHGQNMTIFYKNQLGLYPYFGPRGTAHNGGIPQALPLDRHLALAAYQIHHSLRPGFAGPAVLDWEEWCPLWAGNWGRRRAYQAASWAWAQQVFPDLDPQEQLYKAYTGFEQAARALMEDTLRVAQALRPHGLWGFYHYPACGNGWHSMASNYTGRCHAATLARNTQLHWLWAASSALFPSIYLPPRLPPAHHQAFVRHRLEEAFRVALVGHRHPLPVLAYVRLTHRRSGRFLSQDDLVQSIGVSAALGAAGVVLWGDLSLSSSEEECWHLHDYLVDTLGPYVINVTRAAMACSHQRCHGHGRCARRDPGQMEAFLHLWPDGSLGDWKSFSCHCYWGWAGPTCQEPRPGPKEAV |
Protein accession: | AAH05896 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA |
Shipping condition: | Dry Ice |
Publications: | Hyaluronidase Expression and Activity Is Regulated by Pro-Inflammatory Cytokines in Human Airway Epithelial Cells.Monzon ME, Manzanares D, Schmid N, Casalino-Matsuda SM, Forteza RM. Am J Respir Cell Mol Biol. 2008 Sep;39(3):289-95. Epub 2008 Apr 3. |