Product successfully added to your shopping cart
Quantity
Total
There are 7 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 2 768,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 2 768,00 €
Data sheet of HYAL3 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA |
More info about HYAL3 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00008372-A01 |
| Product name: | HYAL3 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a full-length recombinant HYAL3. |
| Gene id: | 8372 |
| Gene name: | HYAL3 |
| Gene alias: | LUCA-3|LUCA14|LUCA3|Minna14 |
| Gene description: | hyaluronoglucosaminidase 3 |
| Genbank accession: | BC005896 |
| Immunogen: | HYAL3 (AAH05896, 1 a.a. ~ 417 a.a) full-length recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | MTTQLGPALVLGVALCLGCGQPLPQVPERPFSVLWNVPSAHCEARFGVHLPLNSLGIIANRGQHFHGQNMTIFYKNQLGLYPYFGPRGTAHNGGIPQALPLDRHLALAAYQIHHSLRPGFAGPAVLDWEEWCPLWAGNWGRRRAYQAASWAWAQQVFPDLDPQEQLYKAYTGFEQAARALMEDTLRVAQALRPHGLWGFYHYPACGNGWHSMASNYTGRCHAATLARNTQLHWLWAASSALFPSIYLPPRLPPAHHQAFVRHRLEEAFRVALVGHRHPLPVLAYVRLTHRRSGRFLSQDDLVQSIGVSAALGAAGVVLWGDLSLSSSEEECWHLHDYLVDTLGPYVINVTRAAMACSHQRCHGHGRCARRDPGQMEAFLHLWPDGSLGDWKSFSCHCYWGWAGPTCQEPRPGPKEAV |
| Protein accession: | AAH05896 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |
| Publications: | Hyaluronan synthases and hyaluronidases in nasal polyps.Panogeorgou T, Tserbini E, Filou S, Vynios DH, Naxakis SS, Papadas TA, Goumas PD, Mastronikolis NS. Eur Arch Otorhinolaryngol. 2015 Dec 10. [Epub ahead of print] |