Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of HIST1H3H polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA |
More info about HIST1H3H polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00008357-A01 |
| Product name: | HIST1H3H polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a full-length recombinant HIST1H3H. |
| Gene id: | 8357 |
| Gene name: | HIST1H3H |
| Gene alias: | FLJ92264|H3/k|H3F1K|H3FK |
| Gene description: | histone cluster 1, H3h |
| Genbank accession: | BC007518 |
| Immunogen: | HIST1H3H (AAH07518, 1 a.a. ~ 136 a.a) full-length recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALRENRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA |
| Protein accession: | AAH07518 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |