HIST1H3G polyclonal antibody (A01) View larger

HIST1H3G polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HIST1H3G polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about HIST1H3G polyclonal antibody (A01)

Brand: Abnova
Reference: H00008355-A01
Product name: HIST1H3G polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant HIST1H3G.
Gene id: 8355
Gene name: HIST1H3G
Gene alias: H3/h|H3FH
Gene description: histone cluster 1, H3g
Genbank accession: NM_003534
Immunogen: HIST1H3G (NP_003525, 1 a.a. ~ 60 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
Protein accession: NP_003525
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00008355-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (32.71 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy HIST1H3G polyclonal antibody (A01) now

Add to cart