| Brand: | Abnova |
| Reference: | H00008353-A01 |
| Product name: | HIST1H3E polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a full-length recombinant HIST1H3E. |
| Gene id: | 8353 |
| Gene name: | HIST1H3E |
| Gene alias: | H3.1|H3/d|H3FD |
| Gene description: | histone cluster 1, H3e |
| Genbank accession: | BC052981 |
| Immunogen: | HIST1H3E (AAH52981, 1 a.a. ~ 136 a.a) full-length recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA |
| Protein accession: | AAH52981 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (41.07 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |