HIST1H2BC polyclonal antibody (A01) View larger

HIST1H2BC polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HIST1H2BC polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about HIST1H2BC polyclonal antibody (A01)

Brand: Abnova
Reference: H00008347-A01
Product name: HIST1H2BC polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a full-length recombinant HIST1H2BC.
Gene id: 8347
Gene name: HIST1H2BC
Gene alias: H2B.1|H2B/l|H2BFL|MGC104246|dJ221C16.3
Gene description: histone cluster 1, H2bc
Genbank accession: BC009612
Immunogen: HIST1H2BC (AAH09612, 1 a.a. ~ 126 a.a) full-length recombinant protein with GST tag.
Immunogen sequence/protein sequence: MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
Protein accession: AAH09612
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00008347-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (39.97 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy HIST1H2BC polyclonal antibody (A01) now

Add to cart