Brand: | Abnova |
Reference: | H00008341-A01 |
Product name: | HIST1H2BN polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a full-length recombinant HIST1H2BN. |
Gene id: | 8341 |
Gene name: | HIST1H2BN |
Gene alias: | H2B/d|H2BFD|HIST1H3I|MGC125414|MGC125415|MGC125416|MGC9388 |
Gene description: | histone cluster 1, H2bn |
Genbank accession: | BC011372 |
Immunogen: | HIST1H2BN (AAH11372, 1 a.a. ~ 166 a.a) full-length recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | MPEPSKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSKKRKRRFTESIKKAHGFRKLKIWLKLRVSNQSPDDIYIARD |
Protein accession: | AAH11372 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (44.37 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |