Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of HIST2H2AA monoclonal antibody (M01), clone 4C10
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,ELISA,WB-Re |
More info about HIST2H2AA monoclonal antibody (M01), clone 4C10
| Brand: | Abnova |
| Reference: | H00008337-M01 |
| Product name: | HIST2H2AA monoclonal antibody (M01), clone 4C10 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant HIST2H2AA. |
| Clone: | 4C10 |
| Isotype: | IgG2a Kappa |
| Gene id: | 8337 |
| Gene name: | HIST2H2AA3 |
| Gene alias: | H2A|H2A.2|H2A/O|H2A/q|H2AFO|H2a-615|HIST2H2AA |
| Gene description: | histone cluster 2, H2aa3 |
| Genbank accession: | BC001629 |
| Immunogen: | HIST2H2AA (AAH01629, 1 a.a. ~ 130 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHHKAKGK |
| Protein accession: | AAH01629 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (40.04 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunofluorescence of monoclonal antibody to HIST2H2AA3 on HeLa cell . [antibody concentration 10 ug/ml] |
| Applications: | IF,ELISA,WB-Re |
| Shipping condition: | Dry Ice |