Brand: | Abnova |
Reference: | H00008334-M01 |
Product name: | HIST1H2AC monoclonal antibody (M01), clone 4F10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant HIST1H2AC. |
Clone: | 4F10 |
Isotype: | IgG1 Kappa |
Gene id: | 8334 |
Gene name: | HIST1H2AC |
Gene alias: | H2A/l|H2AFL|MGC99519|dJ221C16.4 |
Gene description: | histone cluster 1, H2ac |
Genbank accession: | NM_003512 |
Immunogen: | HIST1H2AC (NP_003503, 25 a.a. ~ 96 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | QFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNK |
Protein accession: | NP_003503 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged HIST1H2AC is 0.1 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |