Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of EOMES monoclonal antibody (M12), clone 1A8
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA |
More info about EOMES monoclonal antibody (M12), clone 1A8
| Brand: | Abnova |
| Reference: | H00008320-M12 |
| Product name: | EOMES monoclonal antibody (M12), clone 1A8 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant EOMES. |
| Clone: | 1A8 |
| Isotype: | IgG2a Kappa |
| Gene id: | 8320 |
| Gene name: | EOMES |
| Gene alias: | TBR2 |
| Gene description: | eomesodermin homolog (Xenopus laevis) |
| Genbank accession: | NM_005442 |
| Immunogen: | EOMES (NP_005433.2, 461 a.a. ~ 569 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SHQIVPGGRYGVQSFFPEPFVNTLPQARYYNGERTVPQTNGLLSPQQSEEVANPPQRWLVTPVQQPGTNKLDISSYESEYTSSTLLPYGIKSLPLQTSHALGYYPDPTF |
| Protein accession: | NP_005433.2 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | EOMES monoclonal antibody (M12), clone 1A8 Western Blot analysis of EOMES expression in IMR-32 ( Cat # L008V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA |
| Shipping condition: | Dry Ice |