EOMES monoclonal antibody (M12), clone 1A8 View larger

EOMES monoclonal antibody (M12), clone 1A8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of EOMES monoclonal antibody (M12), clone 1A8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA

More info about EOMES monoclonal antibody (M12), clone 1A8

Brand: Abnova
Reference: H00008320-M12
Product name: EOMES monoclonal antibody (M12), clone 1A8
Product description: Mouse monoclonal antibody raised against a full length recombinant EOMES.
Clone: 1A8
Isotype: IgG2a Kappa
Gene id: 8320
Gene name: EOMES
Gene alias: TBR2
Gene description: eomesodermin homolog (Xenopus laevis)
Genbank accession: NM_005442
Immunogen: EOMES (NP_005433.2, 461 a.a. ~ 569 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: SHQIVPGGRYGVQSFFPEPFVNTLPQARYYNGERTVPQTNGLLSPQQSEEVANPPQRWLVTPVQQPGTNKLDISSYESEYTSSTLLPYGIKSLPLQTSHALGYYPDPTF
Protein accession: NP_005433.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00008320-M12-1-19-1.jpg
Application image note: EOMES monoclonal antibody (M12), clone 1A8 Western Blot analysis of EOMES expression in IMR-32 ( Cat # L008V1 ).
Applications: WB-Ce,S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy EOMES monoclonal antibody (M12), clone 1A8 now

Add to cart