Brand: | Abnova |
Reference: | H00008318-M02 |
Product name: | CDC45L monoclonal antibody (M02), clone 4C2 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CDC45L. |
Clone: | 4C2 |
Isotype: | IgG2a Kappa |
Gene id: | 8318 |
Gene name: | CDC45L |
Gene alias: | CDC45|CDC45L2|PORC-PI-1 |
Gene description: | CDC45 cell division cycle 45-like (S. cerevisiae) |
Genbank accession: | NM_003504 |
Immunogen: | CDC45L (NP_003495, 477 a.a. ~ 566 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | FVCSTKNRRCKLLPLVMAAPLSMEHGTVTVVGIPPETDSSDRKNFFGRAFEKAAESTSSRMLHNHFDLSVIELKAEDRSKFLDALISLLS |
Protein accession: | NP_003495 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (35.64 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | CDC45L monoclonal antibody (M02), clone 4C2 Western Blot analysis of CDC45L expression in Jurkat ( Cat # L017V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |