Brand: | Abnova |
Reference: | H00008313-M02 |
Product name: | AXIN2 monoclonal antibody (M02), clone 3B6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant AXIN2. |
Clone: | 3B6 |
Isotype: | IgG1 Kappa |
Gene id: | 8313 |
Gene name: | AXIN2 |
Gene alias: | AXIL|DKFZp781B0869|MGC10366|MGC126582 |
Gene description: | axin 2 |
Genbank accession: | NM_004655 |
Immunogen: | AXIN2 (NP_004646, 611 a.a. ~ 710 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | EEGDRSQDVWQWMLESERQSKPKPHSAQSTKKAYPLESARSSPGERASRHHLWGGNSGHPRTTPRAHLFTQDPAMPPLTPPNTLAQLEEACRRLAEVSKP |
Protein accession: | NP_004646 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged AXIN2 is 0.3 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |