Cart 10 Product Products 3 856,84 € (empty)
No products
To be determined Shipping
3 856,84 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 10 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 3 856,84 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 3 856,84 €
Data sheet of KLRC4 monoclonal antibody (M03), clone 1D10
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
More info about KLRC4 monoclonal antibody (M03), clone 1D10
| Brand: | Abnova |
| Reference: | H00008302-M03 |
| Product name: | KLRC4 monoclonal antibody (M03), clone 1D10 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant KLRC4. |
| Clone: | 1D10 |
| Isotype: | IgG2a Kappa |
| Gene id: | 8302 |
| Gene name: | KLRC4 |
| Gene alias: | FLJ17759|FLJ78582|NKG2-F|NKG2F |
| Gene description: | killer cell lectin-like receptor subfamily C, member 4 |
| Genbank accession: | BC017784 |
| Immunogen: | KLRC4 (AAH17784, 1 a.a. ~ 158 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MNKQRGTYSEVSLAQDPKRQQRKLKGNKISISGTKQEIFQVELNLQNASSDHQGNDKTYHCKGLLPPPEKLTAEVLGIICIVLMATVLKTIVLIPCIGVLEQNNFSLNRRMQKARHCGHCPEEWITYSNSCYYIGKERRTWEERVCWPVLRRTLICFL |
| Protein accession: | AAH17784 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (43.12 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of KLRC4 expression in transfected 293T cell line by KLRC4 monoclonal antibody (M03), clone 1D10. Lane 1: KLRC4 transfected lysate(18.2 KDa). Lane 2: Non-transfected lysate. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |