Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00008302-M03 |
Product name: | KLRC4 monoclonal antibody (M03), clone 1D10 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant KLRC4. |
Clone: | 1D10 |
Isotype: | IgG2a Kappa |
Gene id: | 8302 |
Gene name: | KLRC4 |
Gene alias: | FLJ17759|FLJ78582|NKG2-F|NKG2F |
Gene description: | killer cell lectin-like receptor subfamily C, member 4 |
Genbank accession: | BC017784 |
Immunogen: | KLRC4 (AAH17784, 1 a.a. ~ 158 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MNKQRGTYSEVSLAQDPKRQQRKLKGNKISISGTKQEIFQVELNLQNASSDHQGNDKTYHCKGLLPPPEKLTAEVLGIICIVLMATVLKTIVLIPCIGVLEQNNFSLNRRMQKARHCGHCPEEWITYSNSCYYIGKERRTWEERVCWPVLRRTLICFL |
Protein accession: | AAH17784 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (43.12 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of KLRC4 expression in transfected 293T cell line by KLRC4 monoclonal antibody (M03), clone 1D10. Lane 1: KLRC4 transfected lysate(18.2 KDa). Lane 2: Non-transfected lysate. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |