Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of SERF1A polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA |
More info about SERF1A polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00008293-A01 |
| Product name: | SERF1A polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant SERF1A. |
| Gene id: | 8293 |
| Gene name: | SERF1A |
| Gene alias: | 4F5|FAM2A|H4F5|SERF1|SMAM1 |
| Gene description: | small EDRK-rich factor 1A (telomeric) |
| Genbank accession: | NM_021967 |
| Immunogen: | SERF1A (NP_068802, 1 a.a. ~ 82 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | MARGNQRELARQKNMKKTQEISKGKRKEDSLTASQRKQSSGGQKSESKMSAGPHLPLKAPRENPCFPLPAAGGSRYYLAYGS |
| Protein accession: | NP_068802 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |
| Publications: | RNA and protein interactors with TDP-43 in human spinal cord lysates in ALS.Volkening K, Keller B, Leysta-Lantz C, Strong MJ. J Proteome Res. 2018 Apr 6;17(4):1712-1729. doi: 10.1021/acs.jproteome.8b00126. Epub 2018 Mar 22. |