Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of JARID1D monoclonal antibody (M03), clone 4C6
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,WB-Ti,S-ELISA,ELISA,WB-Re |
More info about JARID1D monoclonal antibody (M03), clone 4C6
| Brand: | Abnova |
| Reference: | H00008284-M03 |
| Product name: | JARID1D monoclonal antibody (M03), clone 4C6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant JARID1D. |
| Clone: | 4C6 |
| Isotype: | IgG1 Kappa |
| Gene id: | 8284 |
| Gene name: | JARID1D |
| Gene alias: | HY|HYA|KDM5D|KIAA0234|SMCY |
| Gene description: | jumonji, AT rich interactive domain 1D |
| Genbank accession: | NM_004653.4 |
| Immunogen: | JARID1D (NP_004644.2, 127 a.a. ~ 230 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | AICKDRRWARVAQRLHYPPGKNIGSLLRSHYERIIYPYEMFQSGANHVQCNTHPFDNEVKDKEYKPHSIPLRQSVQPSKFSSYSRRAKRLQPDPEPTEEDIEKH |
| Protein accession: | NP_004644.2 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.07 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged JARID1D is 0.03 ng/ml as a capture antibody. |
| Applications: | WB-Ce,WB-Ti,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |