Brand: | Abnova |
Reference: | H00008284-M03 |
Product name: | JARID1D monoclonal antibody (M03), clone 4C6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant JARID1D. |
Clone: | 4C6 |
Isotype: | IgG1 Kappa |
Gene id: | 8284 |
Gene name: | JARID1D |
Gene alias: | HY|HYA|KDM5D|KIAA0234|SMCY |
Gene description: | jumonji, AT rich interactive domain 1D |
Genbank accession: | NM_004653.4 |
Immunogen: | JARID1D (NP_004644.2, 127 a.a. ~ 230 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | AICKDRRWARVAQRLHYPPGKNIGSLLRSHYERIIYPYEMFQSGANHVQCNTHPFDNEVKDKEYKPHSIPLRQSVQPSKFSSYSRRAKRLQPDPEPTEEDIEKH |
Protein accession: | NP_004644.2 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.07 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged JARID1D is 0.03 ng/ml as a capture antibody. |
Applications: | WB-Ce,WB-Ti,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |