ARD1A purified MaxPab rabbit polyclonal antibody (D01P) View larger

ARD1A purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ARD1A purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Tr

More info about ARD1A purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00008260-D01P
Product name: ARD1A purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human ARD1A protein.
Gene id: 8260
Gene name: ARD1A
Gene alias: ARD1|DXS707|MGC71248|TE2
Gene description: ARD1 homolog A, N-acetyltransferase (S. cerevisiae)
Genbank accession: NM_003491.2
Immunogen: ARD1A (NP_003482.1, 1 a.a. ~ 235 a.a) full-length human protein.
Immunogen sequence/protein sequence: MNIRNARPEDLMNMQHCNLLCLPENYQMKYYFYHGLSWPQLSYIAEDENGKIVGYVLAKMEEDPDDVPHGHITSLAVKRSHRRLGLAQKLMDQASRAMIENFNAKYVSLHVRKSNRAALHLYSNTLNFQISEVEPKYYADGEDAYAMKRDLTQMADELRRHLELKEKGRHVVLGAIENKVESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSAS
Protein accession: NP_003482.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00008260-D01P-13-15-1.jpg
Application image note: Western Blot analysis of ARD1A expression in transfected 293T cell line (H00008260-T02) by ARD1A MaxPab polyclonal antibody.

Lane 1: ARD1A transfected lysate(26.50 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy ARD1A purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart