Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of ARD1A polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA |
More info about ARD1A polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00008260-A01 |
| Product name: | ARD1A polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a full-length recombinant ARD1A. |
| Gene id: | 8260 |
| Gene name: | ARD1A |
| Gene alias: | ARD1|DXS707|MGC71248|TE2 |
| Gene description: | ARD1 homolog A, N-acetyltransferase (S. cerevisiae) |
| Genbank accession: | BC000308 |
| Immunogen: | ARD1A (AAH00308, 1 a.a. ~ 235 a.a) full-length recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | MNIRNARPEDLMNMQHCNLLCLPENYQMKYYFYHGLSWPQLSYIAEDENGKIVGYVLAKMEEDPDDVPHGHITSLAVKRSHRRLGLAQKLMDQASRAMIENFNAKYVSLHVRKSNRAALHLYSNTLNFQISEVEPKYYADGEDAYAMKRDLTQMADELRRHLELKEKGRHVVLGAIENKVESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSAS |
| Protein accession: | AAH00308 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |
| Publications: | Identification of c-myc-dependent proteins in the medulloblastoma cell line D425Med.Azizi AA, Li L, Strobel T, Chen WQ, Slavc I, Lubec G. Amino Acids. 2011 Jun 12. [Epub ahead of print] |