Brand: | Abnova |
Reference: | H00008260-A01 |
Product name: | ARD1A polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a full-length recombinant ARD1A. |
Gene id: | 8260 |
Gene name: | ARD1A |
Gene alias: | ARD1|DXS707|MGC71248|TE2 |
Gene description: | ARD1 homolog A, N-acetyltransferase (S. cerevisiae) |
Genbank accession: | BC000308 |
Immunogen: | ARD1A (AAH00308, 1 a.a. ~ 235 a.a) full-length recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | MNIRNARPEDLMNMQHCNLLCLPENYQMKYYFYHGLSWPQLSYIAEDENGKIVGYVLAKMEEDPDDVPHGHITSLAVKRSHRRLGLAQKLMDQASRAMIENFNAKYVSLHVRKSNRAALHLYSNTLNFQISEVEPKYYADGEDAYAMKRDLTQMADELRRHLELKEKGRHVVLGAIENKVESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSAS |
Protein accession: | AAH00308 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA |
Shipping condition: | Dry Ice |
Publications: | Identification of c-myc-dependent proteins in the medulloblastoma cell line D425Med.Azizi AA, Li L, Strobel T, Chen WQ, Slavc I, Lubec G. Amino Acids. 2011 Jun 12. [Epub ahead of print] |