Brand: | Abnova |
Reference: | H00008243-M01 |
Product name: | SMC1L1 monoclonal antibody (M01), clone 1B9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SMC1L1. |
Clone: | 1B9 |
Isotype: | IgG1 Kappa |
Gene id: | 8243 |
Gene name: | SMC1A |
Gene alias: | CDLS2|DKFZp686L19178|DXS423E|KIAA0178|MGC138332|SB1.8|SMC1|SMC1L1|SMC1alpha|SMCB |
Gene description: | structural maintenance of chromosomes 1A |
Genbank accession: | NM_006306 |
Immunogen: | SMC1L1 (NP_006297, 366 a.a. ~ 465 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | TLEENQVKKYHRLKEEASKRAATLAQELEKFNRDQKADQDRLDLEERKKVETEAKIKQKLREIEENQKRIEKLEEYITTSKQSLEEQKKLEGELTEEVEM |
Protein accession: | NP_006297 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to SMC1L1 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 1 ug/ml] |
Applications: | IHC-P,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |