Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of SMC1L1 monoclonal antibody (M01), clone 1B9
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IHC-P,S-ELISA,ELISA,WB-Re |
More info about SMC1L1 monoclonal antibody (M01), clone 1B9
| Brand: | Abnova |
| Reference: | H00008243-M01 |
| Product name: | SMC1L1 monoclonal antibody (M01), clone 1B9 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SMC1L1. |
| Clone: | 1B9 |
| Isotype: | IgG1 Kappa |
| Gene id: | 8243 |
| Gene name: | SMC1A |
| Gene alias: | CDLS2|DKFZp686L19178|DXS423E|KIAA0178|MGC138332|SB1.8|SMC1|SMC1L1|SMC1alpha|SMCB |
| Gene description: | structural maintenance of chromosomes 1A |
| Genbank accession: | NM_006306 |
| Immunogen: | SMC1L1 (NP_006297, 366 a.a. ~ 465 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | TLEENQVKKYHRLKEEASKRAATLAQELEKFNRDQKADQDRLDLEERKKVETEAKIKQKLREIEENQKRIEKLEEYITTSKQSLEEQKKLEGELTEEVEM |
| Protein accession: | NP_006297 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to SMC1L1 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 1 ug/ml] |
| Applications: | IHC-P,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |