No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,WB-Ti,IF,S-ELISA,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00008239-M05 |
Product name: | USP9X monoclonal antibody (M05), clone 5D7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant USP9X. |
Clone: | 5D7 |
Isotype: | IgG1 Kappa |
Gene id: | 8239 |
Gene name: | USP9X |
Gene alias: | DFFRX|FAF|FAM |
Gene description: | ubiquitin specific peptidase 9, X-linked |
Genbank accession: | NM_021906 |
Immunogen: | USP9X (NP_068706, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MTATTRGSPVGGNDNQGQAPDGQSQPPLQQNQTSSPDSSNENSPATPPDEQGQGDAPPQLEDEEPAFPHTDLAKLDDMINRPRWVVPVLP |
Protein accession: | NP_068706 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (35.64 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Detection limit for recombinant GST tagged USP9X is approximately 0.1ng/ml as a capture antibody. |
Applications: | WB-Ce,WB-Ti,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |