| Brand: | Abnova |
| Reference: | H00008227-M02 |
| Product name: | SFRS17A monoclonal antibody (M02), clone 2G8 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant RP13-297E16.1. |
| Clone: | 2G8 |
| Isotype: | IgG2b Kappa |
| Gene id: | 8227 |
| Gene name: | SFRS17A |
| Gene alias: | 721P|CCDC133|CXYorf3|DXYS155E|MGC125365|MGC125366|MGC39904|XE7|XE7Y |
| Gene description: | splicing factor, arginine/serine-rich 17A |
| Genbank accession: | NM_005088 |
| Immunogen: | SFRS17A (NP_005079, 53 a.a. ~ 156 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | ERLKGMVQNHQFSTLRISKSTMDFIRFEGEVENKSLVKSFLACLDGKTIKLSGFSDILKVRAAEFKIDFPTRHDWDSFFRDAKDMNETLPGERPDTIHLEGLPC |
| Protein accession: | NP_005079 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.18 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | SFRS17A monoclonal antibody (M02), clone 2G8 Western Blot analysis of SFRS17A expression in Hela S3 NE ( Cat # L013V3 ). |
| Applications: | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |