| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
| Brand: | Abnova |
| Reference: | H00008226-M05 |
| Product name: | HDHD1A monoclonal antibody (M05), clone 4F12 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant HDHD1A. |
| Clone: | 4F12 |
| Isotype: | IgG2a Kappa |
| Gene id: | 8226 |
| Gene name: | HDHD1A |
| Gene alias: | DXF68S1E|FAM16AX|GS1 |
| Gene description: | haloacid dehalogenase-like hydrolase domain containing 1A |
| Genbank accession: | NM_012080 |
| Immunogen: | HDHD1A (NP_036212.2, 107 a.a. ~ 212 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | DMKTSRHKEFFSLFSHIVLGDDPEVQHGKPDPDIFLACAKRFSPPPAMEKCLVFEDAPNGVEAALAAGMQVVMVPDGNLSRDLTTKATLVLNSLQDFQPELFGLPS |
| Protein accession: | NP_036212.2 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.4 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of HDHD1A expression in transfected 293T cell line by HDHD1A monoclonal antibody (M05), clone 4F12. Lane 1: HDHD1A transfected lysate (Predicted MW: 23.7 KDa). Lane 2: Non-transfected lysate. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |