| Brand: | Abnova |
| Reference: | H00008200-M06 |
| Product name: | GDF5 monoclonal antibody (M06), clone 1F4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant GDF5. |
| Clone: | 1F4 |
| Isotype: | IgG2a Kappa |
| Gene id: | 8200 |
| Gene name: | GDF5 |
| Gene alias: | BMP14|CDMP1|LAP4|SYNS2 |
| Gene description: | growth differentiation factor 5 |
| Genbank accession: | NM_000557.2 |
| Immunogen: | GDF5 (NP_000548.1, 28 a.a. ~ 127 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | APDLGQRPQGTRPGLAKAEAKERPPLARNVFRPGGHSYGGGATNANARAKGGTGQTGGLTQPKKDEPKKLPPRPGGPEPKPGHPPQTRQATARTVTPKGQ |
| Protein accession: | NP_000548.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | GDF5 monoclonal antibody (M06), clone 1F4. Western Blot analysis of GDF5 expression in HL-60. |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |