Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of SF3A2 monoclonal antibody (M01), clone 3B6
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,S-ELISA,ELISA,WB-Re |
More info about SF3A2 monoclonal antibody (M01), clone 3B6
| Brand: | Abnova |
| Reference: | H00008175-M01 |
| Product name: | SF3A2 monoclonal antibody (M01), clone 3B6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SF3A2. |
| Clone: | 3B6 |
| Isotype: | IgG2b Kappa |
| Gene id: | 8175 |
| Gene name: | SF3A2 |
| Gene alias: | PRP11|PRPF11|SAP62|SF3a66 |
| Gene description: | splicing factor 3a, subunit 2, 66kDa |
| Genbank accession: | NM_007165 |
| Immunogen: | SF3A2 (NP_009096, 112 a.a. ~ 216 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | IGRPGYKVTKQRDSEMGQQSLLFQIDYPEIAEGIMPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYETIAFKVPSREIDKAEGKFWTHWNRETKQFFLQFHFKMEK |
| Protein accession: | NP_009096 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.29 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunofluorescence of monoclonal antibody to SF3A2 on HeLa cell. [antibody concentration 10 ug/ml] |
| Applications: | IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Global tumor protein p53/p63 interactome: making a case for cisplatin chemoresistance.Huang Y, Jeong JS, Okamura J, Sook-Kim M, Zhu H, Guerrero-Preston R, Ratovitski EA Cell Cycle. 2012 Jun 15;11(12):2367-79. doi: 10.4161/cc.20863. Epub 2012 Jun 15. |