Brand: | Abnova |
Reference: | H00008125-M01 |
Product name: | ANP32A monoclonal antibody (M01), clone 2G11-4A5 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant ANP32A. |
Clone: | 2G11-4A5 |
Isotype: | IgG1 Kappa |
Gene id: | 8125 |
Gene name: | ANP32A |
Gene alias: | C15orf1|I1PP2A|LANP|MAPM|MGC119787|MGC150373|PHAP1|PHAPI|PP32 |
Gene description: | acidic (leucine-rich) nuclear phosphoprotein 32 family, member A |
Genbank accession: | BC007200 |
Immunogen: | ANP32A (AAH07200, 1 a.a. ~ 249 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MEMGRRIHLELRNRTPSDVKELVLDNSRSNEGKLEGLTDEFEELEFLSTINVGLTSIANLPKLNKLKKLELSDNRVSGGLEVLAEKCPNLTHLNLSGNKIKDLSTIEPLKKLENLKSLDLFNCEVTNLNDYRENVFKLLPQLTYLDGYDRDDKEAPDSDAEGYVEGLDDEEEDEDEEEYDEDAQVVEDEEDEDEEEEGEEEDVSGEEEEDEEGYNDGEVDDEEDEEELGEEERGQKRKREPEDEGEDDD |
Protein accession: | AAH07200 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (53.13 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to ANP32A on formalin-fixed paraffin-embedded human tonsil tissue. [antibody concentration 3 ug/ml] |
Applications: | WB-Ce,IHC-P,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Quantitative nano-proteomics for protein complexes (QNanoPX) related to estrogen transcriptional action.Cheng PC, Chang HK, Chen SH. Mol Cell Proteomics. 2009 Oct 5. [Epub ahead of print] |