| Brand: | Abnova |
| Reference: | H00008125-A01 |
| Product name: | ANP32A polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a full-length recombinant ANP32A. |
| Gene id: | 8125 |
| Gene name: | ANP32A |
| Gene alias: | C15orf1|I1PP2A|LANP|MAPM|MGC119787|MGC150373|PHAP1|PHAPI|PP32 |
| Gene description: | acidic (leucine-rich) nuclear phosphoprotein 32 family, member A |
| Genbank accession: | BC007200 |
| Immunogen: | ANP32A (AAH07200, 1 a.a. ~ 249 a.a) full-length recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | MEMGRRIHLELRNRTPSDVKELVLDNSRSNEGKLEGLTDEFEELEFLSTINVGLTSIANLPKLNKLKKLELSDNRVSGGLEVLAEKCPNLTHLNLSGNKIKDLSTIEPLKKLENLKSLDLFNCEVTNLNDYRENVFKLLPQLTYLDGYDRDDKEAPDSDAEGYVEGLDDEEEDEDEEEYDEDAQVVEDEEDEDEEEEGEEEDVSGEEEEDEEGYNDGEVDDEEDEEELGEEERGQKRKREPEDEGEDDD |
| Protein accession: | AAH07200 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (53.5 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |