No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IF,WB-Tr |
Brand: | Abnova |
Reference: | H00008089-B01P |
Product name: | YEATS4 purified MaxPab mouse polyclonal antibody (B01P) |
Product description: | Mouse polyclonal antibody raised against a full-length human YEATS4 protein. |
Gene id: | 8089 |
Gene name: | YEATS4 |
Gene alias: | 4930573H17Rik|B230215M10Rik|GAS41|NUBI-1|YAF9 |
Gene description: | YEATS domain containing 4 |
Genbank accession: | BC000994 |
Immunogen: | YEATS4 (AAH00994, 1 a.a. ~ 227 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MFKRMAEFGPDSGGRVKGVTIVKPIVYGNVARYFGKKREEDGHTHQWTVYVKPYRNEDMSAYVKKIQFKLHESYGNPLRVVTKPPYEITETGWGEFEIIIKIFFIDPNERPVTLYHLLKLFQSDTNAMLGKKTVVSEFYDEMIFQDPTAMMQQLLTTSRQLTLGAYKHETEFAELEVKTREKLEAAKKKTSFEIAELKERLKASRETINCLKNEIRKLEEDDQAKDI |
Protein accession: | AAH00994 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of YEATS4 expression in transfected 293T cell line (H00008089-T01) by YEATS4 MaxPab polyclonal antibody. Lane 1: YEATS4 transfected lysate(25.08 KDa). Lane 2: Non-transfected lysate. |
Applications: | IF,WB-Tr |
Shipping condition: | Dry Ice |