| Brand: | Abnova |
| Reference: | H00008086-M02 |
| Product name: | AAAS monoclonal antibody (M02), clone 5A1 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant AAAS. |
| Clone: | 5A1 |
| Isotype: | IgG2a Kappa |
| Gene id: | 8086 |
| Gene name: | AAAS |
| Gene alias: | AAA|AAASb|ADRACALA|ADRACALIN|ALADIN|DKFZp586G1624|GL003 |
| Gene description: | achalasia, adrenocortical insufficiency, alacrimia (Allgrove, triple-A) |
| Genbank accession: | NM_015665 |
| Immunogen: | AAAS (NP_056480, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MCSLGLFPPPPPRGQVTLYEHNNELVTGSSYESPPPDFRGQWINLPVLQLTKDPLKTPGRLDHGTRTAFIHHREQVWKRCINIWRDVGLFGVLNEIANSE |
| Protein accession: | NP_056480 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse,Rat |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to AAAS on formalin-fixed paraffin-embedded human prostate. [antibody concentration 3 ug/ml] |
| Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |