View larger

MFAP5 polyclonal antibody (A01)

Reference:

Condition: New product

Data sheet of MFAP5 polyclonal antibody (A01)

Brand	Abnova
Product type	Primary antibodies
Reactivity	Human
Host species	Mouse
Applications	ELISA,WB-Re

More info about MFAP5 polyclonal antibody (A01)

Brand:	Abnova
Reference:	H00008076-A01
Product name:	MFAP5 polyclonal antibody (A01)
Product description:	Mouse polyclonal antibody raised against a partial recombinant MFAP5.
Gene id:	8076
Gene name:	MFAP5
Gene alias:	MAGP2\|MP25
Gene description:	microfibrillar associated protein 5
Genbank accession:	NM_003480
Immunogen:	MFAP5 (NP_003471, 71 a.a. ~ 173 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence:	DLASLSEKNTTAECWDEKFTCTRLYSVHRPVKQCIHQLCFTSLRRMYIVNKEICSRLVCKEHEAMKDELCRQMAGLPPRRLRRSNYFRLPPCENVDLQRPNGL
Protein accession:	NP_003471
Storage buffer:	50 % glycerol
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody Reactive Against Recombinant Protein.
Quality control testing picture:
Quality control testing picture note:	Western Blot detection against Immunogen (37.44 KDa) .
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Applications:	ELISA,WB-Re
Shipping condition:	Dry Ice
Publications:	Preclinical Profile of a Potent {gamma}-Secretase Inhibitor Targeting Notch Signaling with In vivo Efficacy and Pharmacodynamic Properties.Luistro L, He W, Smith M, Packman K, Vilenchik M, Carvajal D, Roberts J, Cai J, Berkofsky-Fessler W, Hilton H, Linn M, Flohr A, Jakob-Rotne R, Jacobsen H, Glenn K, Heimbrook D, Boylan JF. Cancer Res. 2009 Oct 1;69(19):7672-80. Epub 2009 Sep 22.

Reviews

Be the first to write your review !

Buy MFAP5 polyclonal antibody (A01) now

Add to cart