| Brand: | Abnova |
| Reference: | H00008076-A01 |
| Product name: | MFAP5 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant MFAP5. |
| Gene id: | 8076 |
| Gene name: | MFAP5 |
| Gene alias: | MAGP2|MP25 |
| Gene description: | microfibrillar associated protein 5 |
| Genbank accession: | NM_003480 |
| Immunogen: | MFAP5 (NP_003471, 71 a.a. ~ 173 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | DLASLSEKNTTAECWDEKFTCTRLYSVHRPVKQCIHQLCFTSLRRMYIVNKEICSRLVCKEHEAMKDELCRQMAGLPPRRLRRSNYFRLPPCENVDLQRPNGL |
| Protein accession: | NP_003471 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.44 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Preclinical Profile of a Potent {gamma}-Secretase Inhibitor Targeting Notch Signaling with In vivo Efficacy and Pharmacodynamic Properties.Luistro L, He W, Smith M, Packman K, Vilenchik M, Carvajal D, Roberts J, Cai J, Berkofsky-Fessler W, Hilton H, Linn M, Flohr A, Jakob-Rotne R, Jacobsen H, Glenn K, Heimbrook D, Boylan JF. Cancer Res. 2009 Oct 1;69(19):7672-80. Epub 2009 Sep 22. |