Brand: | Abnova |
Reference: | H00008073-M07 |
Product name: | PTP4A2 monoclonal antibody (M07), clone 3C2 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PTP4A2. |
Clone: | 3C2 |
Isotype: | IgG1 Kappa |
Gene id: | 8073 |
Gene name: | PTP4A2 |
Gene alias: | HH13|HH7-2|HU-PP-1|OV-1|PRL-2|PRL2|PTP4A|PTPCAAX2|ptp-IV1a|ptp-IV1b |
Gene description: | protein tyrosine phosphatase type IVA, member 2 |
Genbank accession: | NM_003479 |
Immunogen: | PTP4A2 (NP_003470.1, 1 a.a. ~ 95 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MNRPAPVEISYENMRFLITHNPTNATLNKFTEELKKYGVTTLVRVCDATYDKAPVEKEGIHVLDWPFDDGAPPPNQIVDDWLNLLKTKFREEPGC |
Protein accession: | NP_003470.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged PTP4A2 is 0.03 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |