Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PTP4A2 monoclonal antibody (M07), clone 3C2
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA |
More info about PTP4A2 monoclonal antibody (M07), clone 3C2
| Brand: | Abnova |
| Reference: | H00008073-M07 |
| Product name: | PTP4A2 monoclonal antibody (M07), clone 3C2 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PTP4A2. |
| Clone: | 3C2 |
| Isotype: | IgG1 Kappa |
| Gene id: | 8073 |
| Gene name: | PTP4A2 |
| Gene alias: | HH13|HH7-2|HU-PP-1|OV-1|PRL-2|PRL2|PTP4A|PTPCAAX2|ptp-IV1a|ptp-IV1b |
| Gene description: | protein tyrosine phosphatase type IVA, member 2 |
| Genbank accession: | NM_003479 |
| Immunogen: | PTP4A2 (NP_003470.1, 1 a.a. ~ 95 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MNRPAPVEISYENMRFLITHNPTNATLNKFTEELKKYGVTTLVRVCDATYDKAPVEKEGIHVLDWPFDDGAPPPNQIVDDWLNLLKTKFREEPGC |
| Protein accession: | NP_003470.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged PTP4A2 is 0.03 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA |
| Shipping condition: | Dry Ice |