| Brand: | Abnova |
| Reference: | H00008050-D01P |
| Product name: | PDHX purified MaxPab rabbit polyclonal antibody (D01P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human PDHX protein. |
| Gene id: | 8050 |
| Gene name: | PDHX |
| Gene alias: | DLDBP|E3BP|OPDX|PDX1|proX |
| Gene description: | pyruvate dehydrogenase complex, component X |
| Genbank accession: | BC010389.1 |
| Immunogen: | PDHX (AAH10389.1, 1 a.a. ~ 501 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MAASWRLGCDPRLLRYLVGFPGRRSVGLVKGALGWSVSRGANWRWFHSTQWLRGDPIKILMPSLSPTMEEGNIVKWLKKEGEAVSAGDALCEIETDKAVVTLDASDDGILAKIVVEEGSKNIRLGSLIGLIVEEGEDWKHVEIPKDVGPPPPVSKPSEPRPSPEPQISIPVKKEHIPGTLRFRLSPAARNILEKHSLDASQGTATGPRGIFTKEDALKLVQLKQTGKITESRPTPAPTATPTAPSPLQATAGPSYPRPVIPPVSTPGQPNAVGTFTEIPASNIRRVIAKRLTESKSTVPHAYATADCDLGAVLKVRQDLVKDDIKVSVNDFIIKAAAVTLKQMPDVNVSWDGEGPKQLPFIDISVAVATVKGLLTPIIKDAAAKGIQEIADSVKALSKKARDGKLLPEEYQGGSFSISNLGMFGIDEFTAVINPPQACILAVGRFRPVLKLTEDEEGNAKLQQRQLITVTMSSDSRVVDDELATRFLKSFKANLENPIRLA |
| Protein accession: | AAH10389.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | PDHX MaxPab rabbit polyclonal antibody. Western Blot analysis of PDHX expression in HepG2. |
| Applications: | WB-Ce,WB-Tr |
| Shipping condition: | Dry Ice |