PDHX polyclonal antibody (A01) View larger

PDHX polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PDHX polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about PDHX polyclonal antibody (A01)

Brand: Abnova
Reference: H00008050-A01
Product name: PDHX polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant PDHX.
Gene id: 8050
Gene name: PDHX
Gene alias: DLDBP|E3BP|OPDX|PDX1|proX
Gene description: pyruvate dehydrogenase complex, component X
Genbank accession: NM_003477
Immunogen: PDHX (NP_003468, 1 a.a. ~ 109 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: MAASWRLGCDPRLLRYLVGFPGRRSVGLVKGALGWSVSRGRNWRWFHSTQWLRGDPIKILMPSLSPTMEEGNIVKWLKKEGEAVSAGDALCEIETDKAVVTLDASDDGI
Protein accession: NP_003468
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00008050-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (38.1 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00008050-A01-1-12-1.jpg
Application image note: PDHX polyclonal antibody (A01), Lot # 051213JCO1 Western Blot analysis of PDHX expression in HepG2 ( Cat # L019V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy PDHX polyclonal antibody (A01) now

Add to cart