Brand: | Abnova |
Reference: | H00008034-M01 |
Product name: | SLC25A16 monoclonal antibody (M01), clone 1H7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SLC25A16. |
Clone: | 1H7 |
Isotype: | IgG2a Kappa |
Gene id: | 8034 |
Gene name: | SLC25A16 |
Gene alias: | D10S105E|GDA|GDC|HGT.1|MGC39851|ML7|hML7 |
Gene description: | solute carrier family 25 (mitochondrial carrier; Graves disease autoantigen), member 16 |
Genbank accession: | NM_152707 |
Immunogen: | SLC25A16 (NP_689920.1, 59 a.a. ~ 133 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | RVKVLLQAHNHHYKHLGVFSALRAVPQKEGFLGLYKGNGAMMIRIFPYGAIQFMAFEHYKTLITTKLGISGHVHR |
Protein accession: | NP_689920.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | SLC25A16 monoclonal antibody (M01), clone 1H7. Western Blot analysis of SLC25A16 expression in HeLa(Cat # L013V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA |
Shipping condition: | Dry Ice |