| Brand: | Abnova |
| Reference: | H00008031-M05 |
| Product name: | NCOA4 monoclonal antibody (M05), clone 1F11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant NCOA4. |
| Clone: | 1F11 |
| Isotype: | IgG1 Lambda |
| Gene id: | 8031 |
| Gene name: | NCOA4 |
| Gene alias: | ARA70|DKFZp762E1112|ELE1|PTC3|RFG |
| Gene description: | nuclear receptor coactivator 4 |
| Genbank accession: | NM_005437 |
| Immunogen: | NCOA4 (NP_005428, 505 a.a. ~ 614 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | EGSPKEVPGTEDRAGKQKFKSPMNTSWCSFNTADWVLPGKKMGNLSQLSSGEDKWLLRKKAQEVLLNSPLQEEHNFPPDHYGLPAVCDLFACMQLKVDKEKWLYRTPLQM |
| Protein accession: | NP_005428 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | NCOA4 monoclonal antibody (M05), clone 1F11 Western Blot analysis of NCOA4 expression in Hela S3 NE ( Cat # L013V3 ). |
| Applications: | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |