Brand: | Abnova |
Reference: | H00008031-A01 |
Product name: | NCOA4 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant NCOA4. |
Gene id: | 8031 |
Gene name: | NCOA4 |
Gene alias: | ARA70|DKFZp762E1112|ELE1|PTC3|RFG |
Gene description: | nuclear receptor coactivator 4 |
Genbank accession: | NM_005437 |
Immunogen: | NCOA4 (NP_005428, 505 a.a. ~ 614 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | EGSPKEVPGTEDRAGKQKFKSPMNTSWCSFNTADWVLPGKKMGNLSQLSSGEDKWLLRKKAQEVLLNSPLQEEHNFPPDHYGLPAVCDLFACMQLKVDKEKWLYRTPLQM |
Protein accession: | NP_005428 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA |
Shipping condition: | Dry Ice |