Brand: | Abnova |
Reference: | H00008030-M03 |
Product name: | CCDC6 monoclonal antibody (M03), clone 5D11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CCDC6. |
Clone: | 5D11 |
Isotype: | IgG1 Kappa |
Gene id: | 8030 |
Gene name: | CCDC6 |
Gene alias: | D10S170|FLJ32286|H4|PTC|TPC|TST1 |
Gene description: | coiled-coil domain containing 6 |
Genbank accession: | NM_005436 |
Immunogen: | CCDC6 (NP_005427, 375 a.a. ~ 474 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | HTVGFTPPTSLTRAGMSYYNSPGLHVQHMGTSHGITRPSPRRSNSPDKFKRPTPPPSPNTQTPVQPPPPPPPPPMQPTVPSAATSQPTPSQHSAHPSSQP |
Protein accession: | NP_005427 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | CCDC6 monoclonal antibody (M03), clone 5D11 Western Blot analysis of CCDC6 expression in K-562 ( Cat # L009V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |