Cart 8 Product Products 2 919,00 € (empty)
No products
To be determined Shipping
2 919,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 8 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 2 919,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 2 919,00 €
Data sheet of STAM purified MaxPab mouse polyclonal antibody (B02P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Rat |
| Host species | Mouse |
| Applications | WB-Ti,WB-Tr |
More info about STAM purified MaxPab mouse polyclonal antibody (B02P)
| Brand: | Abnova |
| Reference: | H00008027-B02P |
| Product name: | STAM purified MaxPab mouse polyclonal antibody (B02P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human STAM protein. |
| Gene id: | 8027 |
| Gene name: | STAM |
| Gene alias: | DKFZp686J2352|STAM1 |
| Gene description: | signal transducing adaptor molecule (SH3 domain and ITAM motif) 1 |
| Genbank accession: | BC030586.2 |
| Immunogen: | STAM (AAH30586.1, 1 a.a. ~ 403 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MPLFATNPFDQDVEKATSEMNTAEDWGLILDICDKVGQSRTGPKDCLRSIMRRVNHKDPHVAMQALTLLGACVSNCGKIFHLEVCSRDFASEVSNVLNKGHPKVCEKLKALMVEWTDEFKNDPQLSLISAMIKNLKEQGVTFPAIGSQAAEQAKASPALVAKDPGTVANKKEEEDLAKAIELSLKEQRQQSTTLSTLYPSTSSLLTNHQHEGRKVRAIYDFEAAEDNELTFKAGEIITVLDDSDPNWWKGETHQGIGLFPSNFVTAYLTAEPEMIKTEKKTVQFSDDVQVETIEPEPEPAFIDEDKMDQLLQMLQSTDPSDDQPDLPELLHLEAMCHQMGPLIDEKLEDIDRKHSELSELNVKVMEALSLYTKLMNEDPMYSMYAKLQNQPGSGPTIRKPSPS |
| Protein accession: | AAH30586.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Rat |
| Application image: |  |
| Application image note: | Western Blot analysis of STAM expression in transfected 293T cell line (H00008027-T03) by STAM MaxPab polyclonal antibody. Lane 1: STAM transfected lysate(45.00 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Ti,WB-Tr |
| Shipping condition: | Dry Ice |